Recombinant Full Length Human CHMP4C Protein, C-Flag-tagged

• Cat.No.: CHMP4C-1711HFL
• Product Overview: Recombinant Full Length Human CHMP4C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 26.2 kDa
• AA Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
  RAASSQRAEEEDDDIKQLAAWATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Endocytosis
• Full Length: Full L.

Gene Information

• Gene Name: CHMP4C charged multivesicular body protein 4C [ Homo sapiens (human) ]
• Official Symbol: CHMP4C
• Synonyms: Shax3; SNF7-3; VPS32C
• Gene ID: 92421
• mRNA Refseq: NM_152284.4
• Protein Refseq: NP_689497.1
• MIM: 610899
• UniProt ID: Q96CF2