Recombinant Full Length Human CLLU1OS Protein, GST-tagged

• Cat.No.: CLLU1OS-1877HF
• Product Overview: Human CLLU1OS full-length ORF ( AAI53087.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 101 amino acids
• Description: CLLU1OS (Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand) is a Protein Coding gene. Diseases associated with CLLU1OS include Chronic Lymphocytic Leukemia.
• Molecular Mass: 38.06 kDa
• AA Sequence: MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand [ Homo sapiens (human) ]
• Official Symbol: CLLU1OS
• Synonyms: CLLU1OS; chronic lymphocytic leukemia up-regulated 1 opposite strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Overlapping Strand; putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein
• Gene ID: 574016
• mRNA Refseq: NM_001025232
• Protein Refseq: NP_001020403
• MIM: 616989
• UniProt ID: Q5K130