Recombinant Full Length Human COMMD8 Protein, GST-tagged

Cat.No. : COMMD8-1945HF
Product Overview : Human COMMD8 full-length ORF ( NP_060315.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 183 amino acids
Description : The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B. [provided by RefSeq, Jul 2016]
Molecular Mass : 47.5 kDa
AA Sequence : MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD8 COMM domain containing 8 [ Homo sapiens ]
Official Symbol COMMD8
Synonyms COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502
Gene ID 54951
mRNA Refseq NM_017845
Protein Refseq NP_060315
MIM 616656
UniProt ID Q9NX08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD8 Products

Required fields are marked with *

My Review for All COMMD8 Products

Required fields are marked with *

0
cart-icon