Recombinant Human COMMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COMMD8-3951H
Product Overview : COMMD8 MS Standard C13 and N15-labeled recombinant protein (NP_060315) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B.
Molecular Mass : 21.1 kDa
AA Sequence : MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COMMD8 COMM domain containing 8 [ Homo sapiens (human) ]
Official Symbol COMMD8
Synonyms COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502;
Gene ID 54951
mRNA Refseq NM_017845
Protein Refseq NP_060315
MIM 616656
UniProt ID Q9NX08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD8 Products

Required fields are marked with *

My Review for All COMMD8 Products

Required fields are marked with *

0
cart-icon