Recombinant Full Length Human COPZ1 Protein, GST-tagged

Cat.No. : COPZ1-1971HF
Product Overview : Human COPZ1 full-length ORF ( NP_057141.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 177 amino acids
Description : This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Molecular Mass : 46.6 kDa
AA Sequence : MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COPZ1 CGI-120 protein [ Homo sapiens ]
Official Symbol COPZ1
Synonyms COPZ1; CGI-120 protein
Gene ID 22818
mRNA Refseq NM_001271734
Protein Refseq NP_001258663
MIM 615472
UniProt ID P61923

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPZ1 Products

Required fields are marked with *

My Review for All COPZ1 Products

Required fields are marked with *

0
cart-icon
0
compare icon