Recombinant Human COPZ1 protein, GST-tagged
Cat.No. : | COPZ1-1666H |
Product Overview : | Recombinant Human COPZ1 protein(31-84 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 31-84 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | COPZ1 CGI-120 protein [ Homo sapiens ] |
Official Symbol | COPZ1 |
Synonyms | COPZ1; CGI-120 protein; |
Gene ID | 51644 |
◆ Recombinant Proteins | ||
COPZ1-11465H | Recombinant Human COPZ1 protein, His-tagged | +Inquiry |
COPZ1-1711H | Recombinant Human COPZ1 Protein, GST-tagged | +Inquiry |
COPZ1-1894M | Recombinant Mouse COPZ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPZ1-1130R | Recombinant Rat COPZ1 Protein, His-tagged | +Inquiry |
COPZ1-3525H | Recombinant Human COPZ1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPZ1-7351HCL | Recombinant Human COPZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPZ1 Products
Required fields are marked with *
My Review for All COPZ1 Products
Required fields are marked with *
0
Inquiry Basket