Recombinant Full Length Human COX7C Protein, GST-tagged
| Cat.No. : | COX7C-2017HF |
| Product Overview : | Human COX7C full-length ORF ( AAH07498, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 63 amino acids |
| Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 32.56 kDa |
| AA Sequence : | MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COX7C cytochrome c oxidase subunit VIIc [ Homo sapiens ] |
| Official Symbol | COX7C |
| Synonyms | COX7C; COX7C_HUMAN; Cytochrome c oxidase polypeptide VIIc; Cytochrome c oxidase subunit 7C; mitochondrial; cytochrome-c oxidase chain VIIc; Cytochrome c oxidase polypeptide VIIc |
| Gene ID | 1350 |
| mRNA Refseq | NM_001867.2 |
| Protein Refseq | NP_001858.1 |
| MIM | 603774 |
| UniProt ID | P15954 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX7C Products
Required fields are marked with *
My Review for All COX7C Products
Required fields are marked with *



