Recombinant Full Length Human CPQ Protein, C-Flag-tagged
| Cat.No. : | CPQ-1422HFL |
| Product Overview : | Recombinant Full Length Human CPQ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Protease |
| Full Length : | Full L. |
| Gene Name | CPQ carboxypeptidase Q [ Homo sapiens (human) ] |
| Official Symbol | CPQ |
| Synonyms | LDP; PGCP |
| Gene ID | 10404 |
| mRNA Refseq | NM_016134.4 |
| Protein Refseq | NP_057218.1 |
| MIM | 618754 |
| UniProt ID | Q9Y646 |
| ◆ Recombinant Proteins | ||
| CPQ-1572R | Recombinant Rat CPQ Protein | +Inquiry |
| CPQ-255H | Recombinant Human CPQ Protein, His-tagged | +Inquiry |
| CPQ-4825C | Recombinant Chicken CPQ | +Inquiry |
| CPQ-1422HFL | Recombinant Full Length Human CPQ Protein, C-Flag-tagged | +Inquiry |
| CPQ-654H | Recombinant Human CPQ Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPQ Products
Required fields are marked with *
My Review for All CPQ Products
Required fields are marked with *
