Recombinant Full Length Human CPQ Protein, C-Flag-tagged
| Cat.No. : | CPQ-1422HFL | 
| Product Overview : | Recombinant Full Length Human CPQ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 51.7 kDa | 
| AA Sequence : | MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Protease | 
| Full Length : | Full L. | 
| Gene Name | CPQ carboxypeptidase Q [ Homo sapiens (human) ] | 
| Official Symbol | CPQ | 
| Synonyms | LDP; PGCP | 
| Gene ID | 10404 | 
| mRNA Refseq | NM_016134.4 | 
| Protein Refseq | NP_057218.1 | 
| MIM | 618754 | 
| UniProt ID | Q9Y646 | 
| ◆ Recombinant Proteins | ||
| CPQ-654H | Recombinant Human CPQ Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Cpq-6771M | Recombinant Mouse Cpq Protein (Lys19-Ser470), C-His tagged | +Inquiry | 
| CPQ-4342H | Recombinant Human CPQ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Cpq-2295M | Recombinant Mouse Cpq Protein, Myc/DDK-tagged | +Inquiry | 
| CPQ-1229R | Recombinant Rat CPQ Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPQ Products
Required fields are marked with *
My Review for All CPQ Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            