Recombinant Full Length Human CSF2RA Protein

• Cat.No.: CSF2RA-2167HF
• Product Overview: Human CSF2RA full-length ORF (NP_006131.2) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 400 amino acids
• Description: The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]
• Form: Liquid
• Molecular Mass: 46.2 kDa
• AA Sequence: MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ]
• Official Symbol: CSF2RA
• Synonyms: CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha
• Gene ID: 1438
• mRNA Refseq: NM_001161529
• Protein Refseq: NP_001155001
• MIM: 306250
• UniProt ID: P15509