Recombinant Full Length Human CSF2RA Protein
| Cat.No. : | CSF2RA-2167HF |
| Product Overview : | Human CSF2RA full-length ORF (NP_006131.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 400 amino acids |
| Description : | The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008] |
| Form : | Liquid |
| Molecular Mass : | 46.2 kDa |
| AA Sequence : | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ] |
| Official Symbol | CSF2RA |
| Synonyms | CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha |
| Gene ID | 1438 |
| mRNA Refseq | NM_001161529 |
| Protein Refseq | NP_001155001 |
| MIM | 306250 |
| UniProt ID | P15509 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2RA Products
Required fields are marked with *
My Review for All CSF2RA Products
Required fields are marked with *




