Recombinant Full Length Human CSRP1 Protein, GST-tagged
Cat.No. : | CSRP1-2216HF |
Product Overview : | Human CSRP1 full-length ORF ( NP_004069.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 193 amino acids |
Description : | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Molecular Mass : | 47 kDa |
AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ] |
Official Symbol | CSRP1 |
Synonyms | CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E; LIM-domain protein; cysteine-rich protein 1; CRP; CRP1; DKFZp686M148 |
Gene ID | 1465 |
mRNA Refseq | NM_001193570 |
Protein Refseq | NP_001180499 |
MIM | 123876 |
UniProt ID | P21291 |
◆ Recombinant Proteins | ||
CSRP1-1234HFL | Recombinant Full Length Human CSRP1 Protein, C-Flag-tagged | +Inquiry |
CSRP1-1641R | Recombinant Rat CSRP1 Protein | +Inquiry |
CSRP1-28020TH | Recombinant Human CSRP1 | +Inquiry |
CSRP1-1299R | Recombinant Rat CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-6681H | Recombinant Human CSRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP1 Products
Required fields are marked with *
My Review for All CSRP1 Products
Required fields are marked with *