Recombinant Full Length Human CSRP1 Protein, GST-tagged

Cat.No. : CSRP1-2216HF
Product Overview : Human CSRP1 full-length ORF ( NP_004069.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 193 amino acids
Description : This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
Molecular Mass : 47 kDa
AA Sequence : MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
Official Symbol CSRP1
Synonyms CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E; LIM-domain protein; cysteine-rich protein 1; CRP; CRP1; DKFZp686M148
Gene ID 1465
mRNA Refseq NM_001193570
Protein Refseq NP_001180499
MIM 123876
UniProt ID P21291

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSRP1 Products

Required fields are marked with *

My Review for All CSRP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon