Recombinant Full Length Human CST7 Protein, GST-tagged
Cat.No. : | CST7-2240HF |
Product Overview : | Human CST7 full-length ORF ( NP_003641.2, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 167 amino acids |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MLPEKALHGHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CST7 cystatin F (leukocystatin) [ Homo sapiens ] |
Official Symbol | CST7 |
Synonyms | CST7; cystatin F (leukocystatin); cystatin-F; cystatin-7; leukocystatin; cystatin-like metastasis-associated protein; CMAP |
Gene ID | 8530 |
mRNA Refseq | NM_003650 |
Protein Refseq | NP_003641 |
MIM | 603253 |
UniProt ID | O76096 |
◆ Recombinant Proteins | ||
CST7-103H | Recombinant Human CST7, His-tagged | +Inquiry |
CST7-2240HF | Recombinant Full Length Human CST7 Protein, GST-tagged | +Inquiry |
CST7-2746H | Recombinant Human CST7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST7-1047H | Active Recombinant Human CST7 Protein, His-tagged | +Inquiry |
CST7-3149H | Recombinant Human CST7, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST7-1522MCL | Recombinant Mouse CST7 cell lysate | +Inquiry |
CST7-2472HCL | Recombinant Human CST7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST7 Products
Required fields are marked with *
My Review for All CST7 Products
Required fields are marked with *