Recombinant Full Length Human CST7 Protein, GST-tagged

Cat.No. : CST7-2240HF
Product Overview : Human CST7 full-length ORF ( NP_003641.2, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.3 kDa
AA Sequence : MLPEKALHGHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CST7 cystatin F (leukocystatin) [ Homo sapiens ]
Official Symbol CST7
Synonyms CST7; cystatin F (leukocystatin); cystatin-F; cystatin-7; leukocystatin; cystatin-like metastasis-associated protein; CMAP
Gene ID 8530
mRNA Refseq NM_003650
Protein Refseq NP_003641
MIM 603253
UniProt ID O76096

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST7 Products

Required fields are marked with *

My Review for All CST7 Products

Required fields are marked with *

0
cart-icon
0
compare icon