Recombinant Mouse Cst7 protein, His&Myc-tagged
| Cat.No. : | Cst7-2749M |
| Product Overview : | Recombinant Mouse Cst7 protein(O89098)(19-144aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-144aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Cst7 cystatin F (leukocystatin) [ Mus musculus ] |
| Official Symbol | Cst7 |
| Synonyms | CST7; cystatin F (leukocystatin); cystatin-F; cystatin 7; cystatin-7; cystatin-like metastasis-associated protein; Cmap; MGC151424; MGC151426; |
| Gene ID | 13011 |
| mRNA Refseq | NM_009977 |
| Protein Refseq | NP_034107 |
| ◆ Recombinant Proteins | ||
| CST7-188H | Recombinant Human CST7 Protein, His-tagged | +Inquiry |
| Cst7-5631M | Recombinant Mouse Cst7 Protein (Ala19-Gln144), C-His tagged | +Inquiry |
| CST7-3150H | Recombinant Human CST7 protein, His-tagged | +Inquiry |
| CST7-679H | Active Recombinant Human CST7 protein, hFc-tagged | +Inquiry |
| CST7-2240HF | Recombinant Full Length Human CST7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST7-1522MCL | Recombinant Mouse CST7 cell lysate | +Inquiry |
| CST7-2472HCL | Recombinant Human CST7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cst7 Products
Required fields are marked with *
My Review for All Cst7 Products
Required fields are marked with *



