Recombinant Full Length Human DHODH Protein, GST-tagged

• Cat.No.: DHODH-2532HF
• Product Overview: Human DHODH full-length ORF (1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 165 amino acids
• Description: The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
• Molecular Mass: 43.9 kDa
• AA Sequence: MVPSHSAPPVCLCSAGMDLTVTGFQWWNTGYGPDSRSRPSSQKLGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSRQDVLEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHODH dihydroorotate dehydrogenase (quinone) [ Homo sapiens ]
• Official Symbol: DHODH
• Synonyms: DHODH; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; URA1; POADS; DHOdehase
• Gene ID: 1723
• mRNA Refseq: NM_001361
• Protein Refseq: NP_001352
• MIM: 126064
• UniProt ID: Q02127