Recombinant Full Length Human DHODH Protein, GST-tagged
| Cat.No. : | DHODH-2532HF |
| Product Overview : | Human DHODH full-length ORF (1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 165 amino acids |
| Description : | The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MVPSHSAPPVCLCSAGMDLTVTGFQWWNTGYGPDSRSRPSSQKLGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSRQDVLEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DHODH dihydroorotate dehydrogenase (quinone) [ Homo sapiens ] |
| Official Symbol | DHODH |
| Synonyms | DHODH; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; URA1; POADS; DHOdehase; |
| Gene ID | 1723 |
| mRNA Refseq | NM_001361 |
| Protein Refseq | NP_001352 |
| MIM | 126064 |
| UniProt ID | Q02127 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHODH Products
Required fields are marked with *
My Review for All DHODH Products
Required fields are marked with *



