Recombinant Full Length Human DOK1 Protein, Flag tagged

• Cat.No.: DOK1-30H
• Product Overview: Recombinant protein of human docking protein 1, 62 kDa (downstream of tyrosine kinase 1) (DOK1) with Flag tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-481 aa
• Description: The protein encoded by this gene is part of a signal transduction pathway downstream of receptor tyrosine kinases. The encoded protein is a scaffold protein that helps form a platform for the assembly of multiprotein signaling complexes. Several transcript variants encoding different isoforms have been found for this gene.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 52.2 kDa
• AASequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: DOK1 docking protein 1, 62kDa (downstream of tyrosine kinase 1) [ Homo sapiens (human) ]
• Official Symbol: DOK1
• Synonyms: DOK1; docking protein 1, 62kDa (downstream of tyrosine kinase 1); docking protein 1, 62kD (downstream of tyrosine kinase 1); docking protein 1; p62dok; pp62; p62(dok); Downstream of tyrosine kinase 1; docking protein 1 (downstream of tyrosine kinase 1); P62DOK; MGC117395; MGC138860
• Gene ID: 1796
• Protein Refseq: NP_001372
• MIM: 602919
• UniProt ID: Q99704