Recombinant Full Length Human DRD2 Protein

Species :	Human
Source :	In Vitro Cell Free System
Protein Length :	443 amino acids
Description :	This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing.
Form :	Liquid
Molecular Mass :	48.73 kDa
AA Sequence :	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Applications :	Antibody Production; Functional Study; Compound Screening
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Name	DRD2 dopamine receptor D2 [ Homo sapiens (human) ]
Official Symbol	DRD2
Synonyms	DRD2; dopamine receptor D2; D2R; D2DR; D(2) dopamine receptor; dopamine D2 receptor; dopamine receptor D2 isoform; seven transmembrane helix receptor
Gene ID	1813
mRNA Refseq	NM_000795
Protein Refseq	NP_000786
MIM	126450
UniProt ID	P14416