Recombinant Full Length Human E2F2 Protein, GST-tagged
| Cat.No. : | E2F2-4111HF |
| Product Overview : | Human E2F2 full-length ORF ( AAH07609, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 83 amino acids |
| Description : | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 34.87 kDa |
| AA Sequence : | MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | E2F2 E2F transcription factor 2 [ Homo sapiens ] |
| Official Symbol | E2F2 |
| Synonyms | E2F2; E2F transcription factor 2; transcription factor E2F2; E2F 2; E2F-2; |
| Gene ID | 1870 |
| mRNA Refseq | NM_004091 |
| Protein Refseq | NP_004082 |
| MIM | 600426 |
| UniProt ID | Q14209 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E2F2 Products
Required fields are marked with *
My Review for All E2F2 Products
Required fields are marked with *



