Recombinant Full Length Human ECHDC1 Protein, GST-tagged
| Cat.No. : | ECHDC1-4163HF |
| Product Overview : | Human ECHDC1 full-length ORF ( AAH03549.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 301 amino acids |
| Description : | ECHDC1 (Ethylmalonyl-CoA Decarboxylase 1) is a Protein Coding gene. Among its related pathways are Fatty Acid Biosynthesis (WikiPathways) and Propanoate metabolism. GO annotations related to this gene include carboxy-lyase activity and methylmalonyl-CoA decarboxylase activity. |
| Molecular Mass : | 59.4 kDa |
| AA Sequence : | MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ] |
| Official Symbol | ECHDC1 |
| Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
| Gene ID | 55862 |
| mRNA Refseq | NM_001002030 |
| Protein Refseq | NP_001002030 |
| MIM | 612136 |
| UniProt ID | Q9NTX5 |
| ◆ Recombinant Proteins | ||
| Echdc1-2717M | Recombinant Mouse Echdc1 Protein, Myc/DDK-tagged | +Inquiry |
| ECHDC1-1373R | Recombinant Rhesus monkey ECHDC1 Protein, His-tagged | +Inquiry |
| ECHDC1-1198R | Recombinant Rhesus Macaque ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHDC1-2622M | Recombinant Mouse ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHDC1-4163HF | Recombinant Full Length Human ECHDC1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
