Recombinant Full Length Human ECHDC1 Protein, GST-tagged

Cat.No. : ECHDC1-4163HF
Product Overview : Human ECHDC1 full-length ORF ( AAH03549.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 301 amino acids
Description : ECHDC1 (Ethylmalonyl-CoA Decarboxylase 1) is a Protein Coding gene. Among its related pathways are Fatty Acid Biosynthesis (WikiPathways) and Propanoate metabolism. GO annotations related to this gene include carboxy-lyase activity and methylmalonyl-CoA decarboxylase activity.
Molecular Mass : 59.4 kDa
AA Sequence : MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ]
Official Symbol ECHDC1
Synonyms ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110;
Gene ID 55862
mRNA Refseq NM_001002030
Protein Refseq NP_001002030
MIM 612136
UniProt ID Q9NTX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECHDC1 Products

Required fields are marked with *

My Review for All ECHDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon