Recombinant Full Length Human EDA2R Protein, GST-tagged
| Cat.No. : | EDA2R-4177HF |
| Product Overview : | Human EDA2R full-length ORF ( NP_068555.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 297 amino acids |
| Description : | The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin, which plays an important role in maintenance of hair and teeth. Alternatively spliced transcript variants encodes distinct protein isoforms. [provided by RefSeq, Apr 2016] |
| Molecular Mass : | 59.1 kDa |
| AA Sequence : | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EDA2R ectodysplasin A2 receptor [ Homo sapiens ] |
| Official Symbol | EDA2R |
| Synonyms | EDA2R; ectodysplasin A2 receptor; tumor necrosis factor receptor superfamily member 27; EDA A2R; EDAA2R; TNFRSF27; XEDAR; EDA-A2 receptor; X-linked ectodysplasin-A2 receptor; tumor necrosis factor receptor superfamily member XEDAR; EDA-A2R; |
| Gene ID | 60401 |
| mRNA Refseq | NM_001199687 |
| Protein Refseq | NP_001186616 |
| MIM | 300276 |
| UniProt ID | Q9HAV5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDA2R Products
Required fields are marked with *
My Review for All EDA2R Products
Required fields are marked with *



