Recombinant Full Length Human EFHD2 Protein, GST-tagged

• Cat.No.: EFHD2-4214HF
• Product Overview: Human EFHD2 full-length ORF ( NP_077305.2, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 240 amino acids
• Description: EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1.
• Molecular Mass: 53.1 kDa
• AA Sequence: MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EFHD2 EF-hand domain family, member D2 [ Homo sapiens ]
• Official Symbol: EFHD2
• Synonyms: EFHD2; EF-hand domain family, member D2; SWS1; RP3-467K16.3
• Gene ID: 79180
• mRNA Refseq: NM_024329
• Protein Refseq: NP_077305
• MIM: 616450
• UniProt ID: Q96C19