Recombinant Full Length Human EI24 Protein, GST-tagged

• Cat.No.: EI24-4395HF
• Product Overview: Human EI24 full-length ORF ( AAH02390, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 340 amino acids
• Description: This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014]
• Molecular Mass: 63.14 kDa
• AA Sequence: MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EI24 EI24, autophagy associated transmembrane protein [ Homo sapiens (human) ]
• Official Symbol: EI24
• Synonyms: EI24; EI24, autophagy associated transmembrane protein; EI24, Autophagy Associated Transmembrane Protein; P53-Induced Gene 8 Protein; Etoposide Induced 2.4; PIG8; Ectopic P-Granules Autophagy Protein 4 Homolog (C. Elegans); Ectopic P-Granules Autophagy Protein 4 Homolog; Etoposide-Induced Protein 2.4 Homolog; Tumor Protein P53 Inducible Protein 8; Etoposide Induced 2.4 MRNA; TP53I8; EPG4; etoposide-induced protein 2.4 homolog; ectopic P-granules autophagy protein 4 homolog; etoposide induced 2.4; p53-induced gene 8 protein; tumor protein p53 inducible protein 8
• Gene ID: 9538
• mRNA Refseq: NM_001290135
• Protein Refseq: NP_001277064
• MIM: 605170
• UniProt ID: O14681