Recombinant Full Length Human ESAM Protein, GST-tagged

• Cat.No.: ESAM-4695HF
• Product Overview: Human ESAM full-length ORF ( AAH16868, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 390 amino acids
• Description: ESAM (Endothelial Cell Adhesion Molecule) is a Protein Coding gene. Among its related pathways are Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways and Integrin Pathway. An important paralog of this gene is IGSF11.
• Molecular Mass: 68.64 kDa
• AA Sequence: MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ESAM endothelial cell adhesion molecule [ Homo sapiens ]
• Official Symbol: ESAM
• Synonyms: ESAM; endothelial cell adhesion molecule; endothelial cell-selective adhesion molecule; W117m; 2310008D05Rik; LP4791 protein; HUEL (C4orf1)-interacting protein
• Gene ID: 90952
• mRNA Refseq: NM_138961
• Protein Refseq: NP_620411
• MIM: 614281
• UniProt ID: Q96AP7