| Description : |
This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5 end and some of which encode protein isoforms differing in the N-terminal region. |
| Source : |
In Vitro Cell Free System |
| Species : |
Human |
| Form : |
Liquid |
| Molecular Mass : |
74.730kDa inclusive of tags |
| Protein Length : |
442 amino acids |
| AA Sequence : |
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGS SDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLY DDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYG VASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ ACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPY LNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPD PTAPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSL ADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDE DQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIAL ANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRA GKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLLLEML EAKV |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
