Recombinant Human ESRRG protein, GST-tagged
| Cat.No. : | ESRRG-3919H |
| Product Overview : | Recombinant Human ESRRG protein(71-260 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 71-260 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | SGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADREL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ESRRG estrogen-related receptor gamma [ Homo sapiens ] |
| Official Symbol | ESRRG |
| Synonyms | ESRRG; estrogen-related receptor gamma; ERR gamma-2; estrogen receptor-related protein 3; nuclear receptor subfamily 3 group B member 3; ERR3; NR3B3; ERRgamma; FLJ16023; KIAA0832; DKFZp781L1617; |
| Gene ID | 2104 |
| mRNA Refseq | NM_001134285 |
| Protein Refseq | NP_001127757 |
| MIM | 602969 |
| UniProt ID | P62508 |
| ◆ Recombinant Proteins | ||
| ESRRG-2105H | Recombinant Human ESRRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ESRRG-4729HF | Recombinant Full Length Human ESRRG Protein, GST-tagged | +Inquiry |
| ESRRG-3511H | Recombinant Human ESRRG Protein, GST-tagged | +Inquiry |
| ESRRG-2870M | Recombinant Mouse ESRRG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ESRRG-5332M | Recombinant Mouse ESRRG Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESRRG-6536HCL | Recombinant Human ESRRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESRRG Products
Required fields are marked with *
My Review for All ESRRG Products
Required fields are marked with *
