Recombinant Full Length Human ETV6 Protein, C-Flag-tagged
Cat.No. : | ETV6-1247HFL |
Product Overview : | Recombinant Full Length Human ETV6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWL KWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSI HTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR RLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILN PRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM KTPDEIMSGRTDRLEHLESQELDEQIYQEDECSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Dorso-ventral axis formation |
Full Length : | Full L. |
Gene Name | ETV6 ETS variant transcription factor 6 [ Homo sapiens (human) ] |
Official Symbol | ETV6 |
Synonyms | TEL; THC5; TEL/ABL |
Gene ID | 2120 |
mRNA Refseq | NM_001987.5 |
Protein Refseq | NP_001978.1 |
MIM | 600618 |
UniProt ID | P41212 |
◆ Recombinant Proteins | ||
ETV6-1512R | Recombinant Rhesus monkey ETV6 Protein, His-tagged | +Inquiry |
ETV6-5354M | Recombinant Mouse ETV6 Protein | +Inquiry |
ETV6-874H | Recombinant Human ETV6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Etv6-981M | Recombinant Mouse Etv6 Protein, MYC/DDK-tagged | +Inquiry |
ETV6-9341Z | Recombinant Zebrafish ETV6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV6-6519HCL | Recombinant Human ETV6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV6 Products
Required fields are marked with *
My Review for All ETV6 Products
Required fields are marked with *
0
Inquiry Basket