Recombinant Full Length Human FAM122A Protein, GST-tagged
Cat.No. : | FAM122A-4507HF |
Product Overview : | Human FAM122A full-length ORF ( NP_612206.3, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 287 amino acids |
Description : | FAM122A (Family With Sequence Similarity 122A) is a Protein Coding gene. An important paralog of this gene is FAM122B. |
Molecular Mass : | 56.9 kDa |
AA Sequence : | MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM122A family with sequence similarity 122A [ Homo sapiens ] |
Official Symbol | FAM122A |
Synonyms | FAM122A; family with sequence similarity 122A; C9orf42, chromosome 9 open reading frame 42; protein FAM122A; MGC17347; C9orf42; |
Gene ID | 116224 |
mRNA Refseq | NM_138333 |
Protein Refseq | NP_612206 |
MIM | 617249 |
UniProt ID | Q96E09 |
◆ Recombinant Proteins | ||
FAM122A-5475M | Recombinant Mouse FAM122A Protein | +Inquiry |
FAM122A-2790C | Recombinant Chicken FAM122A | +Inquiry |
FAM122A-3689H | Recombinant Human FAM122A Protein, GST-tagged | +Inquiry |
FAM122A-1128H | Recombinant Human FAM122A Protein, MYC/DDK-tagged | +Inquiry |
FAM122A-2213R | Recombinant Rat FAM122A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122A-583HCL | Recombinant Human FAM122A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM122A Products
Required fields are marked with *
My Review for All FAM122A Products
Required fields are marked with *
0
Inquiry Basket