Recombinant Full Length Human FAM122A Protein, GST-tagged

Cat.No. : FAM122A-4507HF
Product Overview : Human FAM122A full-length ORF ( NP_612206.3, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 287 amino acids
Description : FAM122A (Family With Sequence Similarity 122A) is a Protein Coding gene. An important paralog of this gene is FAM122B.
Molecular Mass : 56.9 kDa
AA Sequence : MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM122A family with sequence similarity 122A [ Homo sapiens ]
Official Symbol FAM122A
Synonyms FAM122A; family with sequence similarity 122A; C9orf42, chromosome 9 open reading frame 42; protein FAM122A; MGC17347; C9orf42;
Gene ID 116224
mRNA Refseq NM_138333
Protein Refseq NP_612206
MIM 617249
UniProt ID Q96E09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM122A Products

Required fields are marked with *

My Review for All FAM122A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon