Recombinant Full Length Human FIBIN Protein, GST-tagged
| Cat.No. : | FIBIN-4977HF |
| Product Overview : | Human FIBIN full-length ORF ( NP_976249.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 211 amino acids |
| Description : | FIBIN (Fin Bud Initiation Factor Homolog (Zebrafish)) is a Protein Coding gene. Diseases associated with FIBIN include Wilson-Turner Syndrome. |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FIBIN fin bud initiation factor homolog (zebrafish) [ Homo sapiens (human) ] |
| Official Symbol | FIBIN |
| Synonyms | FIBIN; fin bud initiation factor homolog (zebrafish); fin bud initiation factor homolog; Fin Bud Initiation Factor Homolog (Zebrafish) |
| Gene ID | 387758 |
| mRNA Refseq | NM_203371 |
| Protein Refseq | NP_976249 |
| MIM | 617085 |
| UniProt ID | Q8TAL6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIBIN Products
Required fields are marked with *
My Review for All FIBIN Products
Required fields are marked with *



