Recombinant Full Length Human FLJ44635 Protein, GST-tagged
| Cat.No. : | FLJ44635-4918HF |
| Product Overview : | Human FLJ44635 full-length ORF (BAC86606.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 140 amino acids |
| Description : | FLJ44635 (TPT1-Like Protein) is a Protein Coding gene. |
| Molecular Mass : | 41.8 kDa |
| AA Sequence : | METVIMITYWDLISHSEMFSDSYMSQEIADGLRLEVEGKIVSRTEGNIFDSLIGGNASAEGPEGKGTESTVITGVDSVMNHHLQETSFTKEAYNKCIKDYMKSIKGKLEEQRPKRVKPFMTGAAEQIKHILANFKNYQKT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FLJ44635 TPT1-like protein [ Homo sapiens (human) ] |
| Official Symbol | FLJ44635 |
| Synonyms | FLJ44635; TPT1-like protein; TPT1-like protein |
| Gene ID | 392490 |
| mRNA Refseq | NM_207422 |
| Protein Refseq | NP_997305 |
| ◆ Recombinant Proteins | ||
| FLJ44635-2353H | Recombinant Human FLJ44635 Protein, His-tagged | +Inquiry |
| FLJ44635-4918HF | Recombinant Full Length Human FLJ44635 Protein, GST-tagged | +Inquiry |
| FLJ44635-4344H | Recombinant Human FLJ44635 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLJ44635 Products
Required fields are marked with *
My Review for All FLJ44635 Products
Required fields are marked with *
