Recombinant Full Length Human FLOT2 Protein, C-Flag-tagged
Cat.No. : | FLOT2-1555HFL |
Product Overview : | Recombinant Full Length Human FLOT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI KKATGVQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Insulin signaling pathway |
Full Length : | Full L. |
Gene Name | FLOT2 flotillin 2 [ Homo sapiens (human) ] |
Official Symbol | FLOT2 |
Synonyms | ESA; ECS1; ESA1; ECS-1; M17S1 |
Gene ID | 2319 |
mRNA Refseq | NM_004475.3 |
Protein Refseq | NP_004466.2 |
MIM | 131560 |
UniProt ID | Q14254 |
◆ Recombinant Proteins | ||
FLOT2-2827H | Recombinant Human FLOT2 protein, His-tagged | +Inquiry |
FLOT2-4950HF | Recombinant Full Length Human FLOT2 Protein, GST-tagged | +Inquiry |
FLOT2-5924M | Recombinant Mouse FLOT2 Protein | +Inquiry |
FLOT2-3281M | Recombinant Mouse FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FLOT2-2018R | Recombinant Rat FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLOT2-6185HCL | Recombinant Human FLOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLOT2 Products
Required fields are marked with *
My Review for All FLOT2 Products
Required fields are marked with *
0
Inquiry Basket