Recombinant Human FLOT2 Protein, GST-tagged
| Cat.No. : | FLOT2-4362H |
| Product Overview : | Human FLOT2 full-length ORF ( AAH17292, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq |
| Molecular Mass : | 67.43 kDa |
| AA Sequence : | MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FLOT2 flotillin 2 [ Homo sapiens ] |
| Official Symbol | FLOT2 |
| Synonyms | FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; Flotillin 2 (epidermal surface antigen 1); membrane component; chromosome 17; surface marker 1 (35kD protein identified by monoclonal ECS 1); epidermal surface antigen; membrane component chromosome 17 surface marker 1; membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal ECS-1); ECS-1; |
| Gene ID | 2319 |
| mRNA Refseq | NM_004475 |
| Protein Refseq | NP_004466 |
| MIM | 131560 |
| UniProt ID | Q14254 |
| ◆ Recombinant Proteins | ||
| FLOT2-2827H | Recombinant Human FLOT2 protein, His-tagged | +Inquiry |
| FLOT2-1506H | Recombinant Human FLOT2 Protein, His-tagged | +Inquiry |
| FLOT2-934H | Recombinant Human FLOT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FLOT2-2420C | Recombinant Chicken FLOT2 | +Inquiry |
| FLOT2-4950HF | Recombinant Full Length Human FLOT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLOT2-6185HCL | Recombinant Human FLOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLOT2 Products
Required fields are marked with *
My Review for All FLOT2 Products
Required fields are marked with *
