Recombinant Full Length Human GADD45B Protein, GST-tagged
Cat.No. : | GADD45B-5207HF |
Product Overview : | Human GADD45B full-length ORF ( ADR83481.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 160 amino acids |
Description : | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens ] |
Official Symbol | GADD45B |
Synonyms | GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133; |
Gene ID | 4616 |
mRNA Refseq | NM_015675 |
Protein Refseq | NP_056490 |
MIM | 604948 |
UniProt ID | O75293 |
◆ Recombinant Proteins | ||
GADD45B-292H | Recombinant Human GADD45B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GADD45B-5207HF | Recombinant Full Length Human GADD45B Protein, GST-tagged | +Inquiry |
GADD45B-13110H | Recombinant Human GADD45B, GST-tagged | +Inquiry |
GADD45B-4659H | Recombinant Human GADD45B Protein, GST-tagged | +Inquiry |
Gadd45b-3131M | Recombinant Mouse Gadd45b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45B-6054HCL | Recombinant Human GADD45B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45B Products
Required fields are marked with *
My Review for All GADD45B Products
Required fields are marked with *