Recombinant Full Length Human GADD45B Protein, GST-tagged

Cat.No. : GADD45B-5207HF
Product Overview : Human GADD45B full-length ORF ( ADR83481.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 160 amino acids
Description : This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq
Molecular Mass : 17.6 kDa
AA Sequence : MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens ]
Official Symbol GADD45B
Synonyms GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133;
Gene ID 4616
mRNA Refseq NM_015675
Protein Refseq NP_056490
MIM 604948
UniProt ID O75293

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GADD45B Products

Required fields are marked with *

My Review for All GADD45B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon