Recombinant Full Length Human GADD45G Protein, GST-tagged

Cat.No. : GADD45G-5208HF
Product Overview : Human GADD45G full-length ORF ( AAH19325, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 159 amino acids
Description : This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq
Molecular Mass : 43.23 kDa
AA Sequence : MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ]
Official Symbol GADD45G
Synonyms GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein;
Gene ID 10912
mRNA Refseq NM_006705
Protein Refseq NP_006696
MIM 604949
UniProt ID O95257

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GADD45G Products

Required fields are marked with *

My Review for All GADD45G Products

Required fields are marked with *

0
cart-icon