Recombinant Full Length Human GADD45G Protein, GST-tagged
Cat.No. : | GADD45G-5208HF |
Product Overview : | Human GADD45G full-length ORF ( AAH19325, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 159 amino acids |
Description : | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq |
Molecular Mass : | 43.23 kDa |
AA Sequence : | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ] |
Official Symbol | GADD45G |
Synonyms | GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; |
Gene ID | 10912 |
mRNA Refseq | NM_006705 |
Protein Refseq | NP_006696 |
MIM | 604949 |
UniProt ID | O95257 |
◆ Recombinant Proteins | ||
GADD45G-1800R | Recombinant Rhesus monkey GADD45G Protein, His-tagged | +Inquiry |
GADD45G-26076TH | Recombinant Human GADD45G, His-tagged | +Inquiry |
GADD45G-2937H | Recombinant Human GADD45G protein, His-SUMO-tagged | +Inquiry |
GADD45G-1559H | Recombinant Human GADD45G Protein, His-tagged | +Inquiry |
Gadd45g-1560R | Recombinant Rat Gadd45g Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45G-6053HCL | Recombinant Human GADD45G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45G Products
Required fields are marked with *
My Review for All GADD45G Products
Required fields are marked with *
0
Inquiry Basket