Recombinant Full Length Human GADD45G Protein, GST-tagged
| Cat.No. : | GADD45G-5208HF | 
| Product Overview : | Human GADD45G full-length ORF ( AAH19325, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 159 amino acids | 
| Description : | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq | 
| Molecular Mass : | 43.23 kDa | 
| AA Sequence : | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ] | 
| Official Symbol | GADD45G | 
| Synonyms | GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; | 
| Gene ID | 10912 | 
| mRNA Refseq | NM_006705 | 
| Protein Refseq | NP_006696 | 
| MIM | 604949 | 
| UniProt ID | O95257 | 
| ◆ Recombinant Proteins | ||
| GADD45G-11714Z | Recombinant Zebrafish GADD45G | +Inquiry | 
| GADD45G-1621R | Recombinant Rhesus Macaque GADD45G Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Gadd45g-1560R | Recombinant Rat Gadd45g Protein, His-tagged | +Inquiry | 
| GADD45G-4660H | Recombinant Human GADD45G Protein, GST-tagged | +Inquiry | 
| Gadd45g-1853M | Recombinant Mouse Gadd45g protein, His & T7-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GADD45G-6053HCL | Recombinant Human GADD45G 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All GADD45G Products
Required fields are marked with *
My Review for All GADD45G Products
Required fields are marked with *
  
        
    
      
            