Recombinant Full Length Human GADL1 Protein, GST-tagged

Cat.No. : GADL1-5210HF
Product Overview : Human GADL1 full-length ORF (BAC87546.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 337 amino acids
Description : GADL1 (Glutamate Decarboxylase Like 1) is a Protein Coding gene. Diseases associated with GADL1 include Gadl1-Related Altered Drug Metabolism. Among its related pathways are Amino acid synthesis and interconversion (transamination) and Viral mRNA Translation. GO annotations related to this gene include pyridoxal phosphate binding and sulfinoalanine decarboxylase activity. An important paralog of this gene is CSAD.
Molecular Mass : 64.9 kDa
AA Sequence : MYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLVDEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GADL1 glutamate decarboxylase-like 1 [ Homo sapiens ]
Official Symbol GADL1
Synonyms GADL1; glutamate decarboxylase-like 1; Glutamate Decarboxylase Like 1; Glutamate Decarboxylase-Like Protein 1; Cysteine Sulfinic Acid Decarboxylase; Aspartate 1-Decarboxylase; EC 4.1.1.29; HuCSADC; CSADC; HuADC; ADC; Acidic Amino Acid Decarboxylase GADL1; Glutamate Decarboxylase-Like 1; EC 4.1.1.15; EC 4.1.1.11; EC 4.1.1
Gene ID 339896
mRNA Refseq NM_207359
Protein Refseq NP_997242
MIM 615601
UniProt ID Q6ZQY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GADL1 Products

Required fields are marked with *

My Review for All GADL1 Products

Required fields are marked with *

0
cart-icon