Recombinant Full Length Human GAGE12B Protein, GST-tagged

Cat.No. : GAGE12B-5213HF
Product Overview : Human GAGE12B full-length ORF (ADR82812.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 117 amino acids
Description : GAGE12B (G Antigen 12B) is a Protein Coding gene.
Molecular Mass : 39.3 kDa
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAGE12B G antigen 12B [ Homo sapiens (human) ]
Official Symbol GAGE12B
Synonyms GAGE12B; G antigen 12B; GAGE-12B; G antigen 12B/C/D/E
Gene ID 729428
mRNA Refseq NM_001127345
Protein Refseq NP_001120817
UniProt ID A1L429

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAGE12B Products

Required fields are marked with *

My Review for All GAGE12B Products

Required fields are marked with *

0
cart-icon