Recombinant Full Length Human GAGE12B Protein, GST-tagged
Cat.No. : | GAGE12B-5213HF |
Product Overview : | Human GAGE12B full-length ORF (ADR82812.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 117 amino acids |
Description : | GAGE12B (G Antigen 12B) is a Protein Coding gene. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAGE12B G antigen 12B [ Homo sapiens (human) ] |
Official Symbol | GAGE12B |
Synonyms | GAGE12B; G antigen 12B; GAGE-12B; G antigen 12B/C/D/E |
Gene ID | 729428 |
mRNA Refseq | NM_001127345 |
Protein Refseq | NP_001120817 |
UniProt ID | A1L429 |
◆ Recombinant Proteins | ||
GAGE12B-4665H | Recombinant Human GAGE12B Protein, GST-tagged | +Inquiry |
GAGE12B-5213HF | Recombinant Full Length Human GAGE12B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE12B Products
Required fields are marked with *
My Review for All GAGE12B Products
Required fields are marked with *