Recombinant Full Length Human GCLC Protein, C-Flag-tagged
Cat.No. : | GCLC-881HFL |
Product Overview : | Recombinant Full Length Human GCLC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.6 kDa |
AA Sequence : | MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLS GEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQA LCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRFSTLTRNIRHRRGEKVVINVPIFKD KNTPSPFIETFTEDDEASRASKPDHIYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALS AASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTI DKEIYEQLLQEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDI CKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNSYLENMEVDVDTRCSILNYLK LIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSG SKTDSSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GCLC glutamate-cysteine ligase catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | GCLC |
Synonyms | GCL; GCS; GLCL; GLCLC |
Gene ID | 2729 |
mRNA Refseq | NM_001498.4 |
Protein Refseq | NP_001489.1 |
MIM | 606857 |
UniProt ID | P48506 |
◆ Recombinant Proteins | ||
GCLC-9909Z | Recombinant Zebrafish GCLC | +Inquiry |
GCLC-1643R | Recombinant Rhesus Macaque GCLC Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLC-5174HF | Recombinant Full Length Human GCLC Protein, GST-tagged | +Inquiry |
GCLC-192HF | Recombinant Full Length Human GCLC Protein | +Inquiry |
GCLC-8215H | Recombinant Human GCLC protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCLC-5983HCL | Recombinant Human GCLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCLC Products
Required fields are marked with *
My Review for All GCLC Products
Required fields are marked with *
0
Inquiry Basket