Recombinant Human GCLC

Cat.No. : GCLC-28158TH
Product Overview : Recombinant fragment corresponding to amino acids 528-637 of Human GCLC with a proprietary tag; Predicted MWt 37.73.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.
Molecular Weight : 37.730kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Sequence Similarities : Belongs to the glutamate--cysteine ligase type 3 family.
Gene Name GCLC glutamate-cysteine ligase, catalytic subunit [ Homo sapiens ]
Official Symbol GCLC
Synonyms GCLC; glutamate-cysteine ligase, catalytic subunit; GLCL, GLCLC; glutamate--cysteine ligase catalytic subunit; GCS;
Gene ID 2729
mRNA Refseq NM_001197115
Protein Refseq NP_001184044
MIM 606857
Uniprot ID P48506
Chromosome Location 6p12
Pathway Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem;
Function ADP binding; ATP binding; coenzyme binding; glutamate binding; glutamate-cysteine ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCLC Products

Required fields are marked with *

My Review for All GCLC Products

Required fields are marked with *

0
cart-icon