Recombinant Human GCLC
Cat.No. : | GCLC-28158TH |
Product Overview : | Recombinant fragment corresponding to amino acids 528-637 of Human GCLC with a proprietary tag; Predicted MWt 37.73. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction. |
Molecular Weight : | 37.730kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN |
Sequence Similarities : | Belongs to the glutamate--cysteine ligase type 3 family. |
Gene Name | GCLC glutamate-cysteine ligase, catalytic subunit [ Homo sapiens ] |
Official Symbol | GCLC |
Synonyms | GCLC; glutamate-cysteine ligase, catalytic subunit; GLCL, GLCLC; glutamate--cysteine ligase catalytic subunit; GCS; |
Gene ID | 2729 |
mRNA Refseq | NM_001197115 |
Protein Refseq | NP_001184044 |
MIM | 606857 |
Uniprot ID | P48506 |
Chromosome Location | 6p12 |
Pathway | Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem; |
Function | ADP binding; ATP binding; coenzyme binding; glutamate binding; glutamate-cysteine ligase activity; |
◆ Recombinant Proteins | ||
GCLC-881HFL | Recombinant Full Length Human GCLC Protein, C-Flag-tagged | +Inquiry |
GCLC-2148R | Recombinant Rat GCLC Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLC-668H | Recombinant Human GCLC Protein, MYC/DDK-tagged | +Inquiry |
GCLC-4800H | Recombinant Human GCLC Protein, GST-tagged | +Inquiry |
GCLC-9909Z | Recombinant Zebrafish GCLC | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCLC-5983HCL | Recombinant Human GCLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCLC Products
Required fields are marked with *
My Review for All GCLC Products
Required fields are marked with *