Recombinant Human GCLC
| Cat.No. : | GCLC-28158TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 528-637 of Human GCLC with a proprietary tag; Predicted MWt 37.73. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN |
| Sequence Similarities : | Belongs to the glutamate--cysteine ligase type 3 family. |
| Gene Name | GCLC glutamate-cysteine ligase, catalytic subunit [ Homo sapiens ] |
| Official Symbol | GCLC |
| Synonyms | GCLC; glutamate-cysteine ligase, catalytic subunit; GLCL, GLCLC; glutamate--cysteine ligase catalytic subunit; GCS; |
| Gene ID | 2729 |
| mRNA Refseq | NM_001197115 |
| Protein Refseq | NP_001184044 |
| MIM | 606857 |
| Uniprot ID | P48506 |
| Chromosome Location | 6p12 |
| Pathway | Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem; |
| Function | ADP binding; ATP binding; coenzyme binding; glutamate binding; glutamate-cysteine ligase activity; |
| ◆ Recombinant Proteins | ||
| GCLC-2492R | Recombinant Rat GCLC Protein | +Inquiry |
| Gclc-8216M | Recombinant Mouse Gclc protein, His-tagged | +Inquiry |
| GCLC-1822R | Recombinant Rhesus monkey GCLC Protein, His-tagged | +Inquiry |
| GCLC-192HF | Recombinant Full Length Human GCLC Protein | +Inquiry |
| GCLC-8215H | Recombinant Human GCLC protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GCLC-5983HCL | Recombinant Human GCLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCLC Products
Required fields are marked with *
My Review for All GCLC Products
Required fields are marked with *
