Recombinant Full Length Human GCLM Protein
| Cat.No. : | GCLM-193HF |
| Product Overview : | Recombinant full length Human GCLM with N terminal proprietary tag; Predicted MWt 56.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 274 amino acids |
| Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. |
| Form : | Liquid |
| Molecular Mass : | 56.250kDa inclusive of tags |
| AA Sequence : | MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHS EELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVEK INPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIV AIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL TAFAKQFDIQLLTHNDPKELLSGASFQEALQESIPDIQAH EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GCLM glutamate-cysteine ligase, modifier subunit [ Homo sapiens ] |
| Official Symbol | GCLM |
| Synonyms | GCLM; glutamate-cysteine ligase, modifier subunit; GLCLR; glutamate--cysteine ligase regulatory subunit; gamma glutamylcysteine synthetase |
| Gene ID | 2730 |
| mRNA Refseq | NM_002061 |
| Protein Refseq | NP_002052 |
| MIM | 601176 |
| UniProt ID | P48507 |
| ◆ Recombinant Proteins | ||
| GCLM-3508M | Recombinant Mouse GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
| GCLM-5175HF | Recombinant Full Length Human GCLM Protein, GST-tagged | +Inquiry |
| GCLM-13195H | Recombinant Human GCLM, His-tagged | +Inquiry |
| GCLM-1237HFL | Recombinant Full Length Human GCLM Protein, C-Flag-tagged | +Inquiry |
| GCLM-3049H | Recombinant Human GCLM Protein (Ser40-Ser251), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GCLM-173HKCL | Human GCLM Knockdown Cell Lysate | +Inquiry |
| GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCLM Products
Required fields are marked with *
My Review for All GCLM Products
Required fields are marked with *



