Recombinant Full Length Human GCLM Protein
Cat.No. : | GCLM-193HF |
Product Overview : | Recombinant full length Human GCLM with N terminal proprietary tag; Predicted MWt 56.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 56.250kDa inclusive of tags |
Protein Length : | 274 amino acids |
AA Sequence : | MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHS EELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVEK INPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIV AIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL TAFAKQFDIQLLTHNDPKELLSGASFQEALQESIPDIQAH EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | GCLM glutamate-cysteine ligase, modifier subunit [ Homo sapiens ] |
Official Symbol : | GCLM |
Synonyms : | GCLM; glutamate-cysteine ligase, modifier subunit; GLCLR; glutamate--cysteine ligase regulatory subunit; gamma glutamylcysteine synthetase |
Gene ID : | 2730 |
mRNA Refseq : | NM_002061 |
Protein Refseq : | NP_002052 |
MIM : | 601176 |
UniProt ID : | P48507 |
Products Types
◆ Recombinant Protein | ||
GCLM-3508M | Recombinant Mouse GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-655H | Recombinant Human GCLM Protein, MYC/DDK-tagged | +Inquiry |
GCLM-2149R | Recombinant Rat GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-4802H | Recombinant Human GCLM Protein, GST-tagged | +Inquiry |
GCLM-974H | Recombinant Human GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket