Recombinant Full Length Human GCLM Protein, C-Flag-tagged
Cat.No. : | GCLM-1237HFL |
Product Overview : | Recombinant Full Length Human GCLM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GCLM glutamate-cysteine ligase modifier subunit [ Homo sapiens (human) ] |
Official Symbol | GCLM |
Synonyms | GLCLR |
Gene ID | 2730 |
mRNA Refseq | NM_002061.4 |
Protein Refseq | NP_002052.1 |
MIM | 601176 |
UniProt ID | P48507 |
◆ Recombinant Proteins | ||
GCLM-3508M | Recombinant Mouse GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-1807C | Recombinant Chicken GCLM | +Inquiry |
GCLM-5456H | Recombinant Human GCLM protein, His-tagged | +Inquiry |
GCLM-13195H | Recombinant Human GCLM, His-tagged | +Inquiry |
GCLM-974H | Recombinant Human GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCLM Products
Required fields are marked with *
My Review for All GCLM Products
Required fields are marked with *
0
Inquiry Basket