Recombinant Full Length Human GEMIN6 Protein, GST-tagged

Cat.No. : GEMIN6-5311HF
Product Overview : Human GEMIN6 full-length ORF ( AAH18195, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM
Molecular Mass : 44.11 kDa
AA Sequence : MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GEMIN6 gem (nuclear organelle) associated protein 6 [ Homo sapiens ]
Official Symbol GEMIN6
Synonyms GEMIN6; gem (nuclear organelle) associated protein 6; gem-associated protein 6; FLJ23459; SIP2; gemin 6; gemin-6;
Gene ID 79833
mRNA Refseq NM_024775
Protein Refseq NP_079051
MIM 607006
UniProt ID Q8WXD5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GEMIN6 Products

Required fields are marked with *

My Review for All GEMIN6 Products

Required fields are marked with *

0
cart-icon