Recombinant Full Length Human GLOD5 Protein, C-Flag-tagged
| Cat.No. : | GLOD5-1161HFL |
| Product Overview : | Recombinant Full Length Human GLOD5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a protein with a glyoxalase domain. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 18.1 kDa |
| AA Sequence : | MLRHLPSRLPVKMWGRTLEKQSWRDSSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDR KALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIM SIYFRDPDRNLIEVSNYISSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | GLOD5 glyoxalase domain containing 5 [ Homo sapiens (human) ] |
| Official Symbol | GLOD5 |
| Synonyms | glyoxalase domain containing 5 |
| Gene ID | 392465 |
| mRNA Refseq | NM_001080489.3 |
| Protein Refseq | NP_001073958.2 |
| UniProt ID | A6NK44 |
| ◆ Recombinant Proteins | ||
| GLOD5-987H | Recombinant Human GLOD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLOD5-3600M | Recombinant Mouse GLOD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLOD5-1161HFL | Recombinant Full Length Human GLOD5 Protein, C-Flag-tagged | +Inquiry |
| GLOD5-6413M | Recombinant Mouse GLOD5 Protein | +Inquiry |
| Glod5-3228M | Recombinant Mouse Glod5 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLOD5 Products
Required fields are marked with *
My Review for All GLOD5 Products
Required fields are marked with *
