Recombinant Full Length Human Glycophorin-C(Gypc) Protein, His-Tagged
| Cat.No. : | RFL26130HF |
| Product Overview : | Recombinant Full Length Human Glycophorin-C(GYPC) Protein (P04921) (1-128aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-128) |
| Form : | Lyophilized powder |
| AA Sequence : | MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | GYPC |
| Synonyms | GYPC; GLPC; GPC; Glycophorin-C; Glycoconnectin; Glycophorin-D; GPD; Glycoprotein beta; PAS-2'; Sialoglycoprotein D; CD antigen CD236 |
| UniProt ID | P04921 |
| ◆ Recombinant Proteins | ||
| GYPC-1833H | Recombinant Human GYPC protein, His & GST-tagged | +Inquiry |
| GYPC-1162H | Recombinant Human GYPC Protein (Met1-Ile128), N-GST tagged | +Inquiry |
| GYPC-4229H | Recombinant Human GYPC Protein (Met1-Met57), C-His tagged | +Inquiry |
| GYPC-7406M | Recombinant Mouse GYPC Protein | +Inquiry |
| GYPC-2421R | Recombinant Rat GYPC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GYPC-350HKCL | Human GYPC Knockdown Cell Lysate | +Inquiry |
| GYPC-769HCL | Recombinant Human GYPC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYPC Products
Required fields are marked with *
My Review for All GYPC Products
Required fields are marked with *



