Recombinant Full Length Human GNRH1 Protein, C-Flag-tagged
Cat.No. : | GNRH1-1845HFL |
Product Overview : | Recombinant Full Length Human GNRH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS PLRDLKGALESLIEEETGQKKI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | GnRH signaling pathway |
Full Length : | Full L. |
Gene Name | GNRH1 gonadotropin releasing hormone 1 [ Homo sapiens (human) ] |
Official Symbol | GNRH1 |
Synonyms | GRH; GNRH; LHRH; LNRH |
Gene ID | 2796 |
mRNA Refseq | NM_000825.3 |
Protein Refseq | NP_000816.4 |
MIM | 152760 |
UniProt ID | P01148 |
◆ Recombinant Proteins | ||
GNRH1-5096H | Recombinant Human GNRH1 Protein, GST-tagged | +Inquiry |
GNRH1-2614R | Recombinant Rat GNRH1 Protein | +Inquiry |
GNRH1-306H | Human Gonadotropin-releasing Hormone 1 (Luteinizing-releasing Hormone) | +Inquiry |
GNRH1-1735R | Recombinant Rhesus Macaque GNRH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNRH1-7055M | Recombinant Mouse GNRH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNRH1-5839HCL | Recombinant Human GNRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNRH1 Products
Required fields are marked with *
My Review for All GNRH1 Products
Required fields are marked with *
0
Inquiry Basket