Recombinant Full Length Human GOLPH3 Protein, GST-tagged
| Cat.No. : | GOLPH3-5449HF |
| Product Overview : | Human GOLPH3 full-length ORF ( NP_071413.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 298 amino acids |
| Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq |
| Molecular Mass : | 60.2 kDa |
| AA Sequence : | MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ] |
| Official Symbol | GOLPH3 |
| Synonyms | GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS; coat-protein; coat protein GPP34; golgi-associated protein; mitochondrial DNA absence factor; golgi peripheral membrane protein 1, 34 kDa; FLJ90675; |
| Gene ID | 64083 |
| mRNA Refseq | NM_022130 |
| Protein Refseq | NP_071413 |
| MIM | 612207 |
| UniProt ID | Q9H4A6 |
| ◆ Recombinant Proteins | ||
| GOLPH3-1611Z | Recombinant Zebrafish GOLPH3 | +Inquiry |
| GOLPH3-5113H | Recombinant Human GOLPH3 Protein, GST-tagged | +Inquiry |
| GOLPH3-7068M | Recombinant Mouse GOLPH3 Protein | +Inquiry |
| Golph3-3270M | Recombinant Mouse Golph3 Protein, Myc/DDK-tagged | +Inquiry |
| GOLPH3-26785TH | Recombinant Human GOLPH3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GOLPH3-728HCL | Recombinant Human GOLPH3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLPH3 Products
Required fields are marked with *
My Review for All GOLPH3 Products
Required fields are marked with *
