Recombinant Human GOLPH3
Cat.No. : | GOLPH3-26785TH |
Product Overview : | Recombinant full length Human GOLPH3 with proprietary tag; Predicted MWt 58.85 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 298 amino acids |
Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
Molecular Weight : | 58.850kDa inclusive of tags |
Tissue specificity : | Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
Sequence Similarities : | Belongs to the GOLPH3/VPS74 family. |
Gene Name | GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ] |
Official Symbol | GOLPH3 |
Synonyms | GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS; |
Gene ID | 64083 |
mRNA Refseq | NM_022130 |
Protein Refseq | NP_071413 |
MIM | 612207 |
Uniprot ID | Q9H4A6 |
Chromosome Location | 5p13.2 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; lysine fermentation to acetate and butyrate, organism-specific biosystem; superpathway of lysine degradation, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
GOLPH3-5449HF | Recombinant Full Length Human GOLPH3 Protein, GST-tagged | +Inquiry |
GOLPH3-1611Z | Recombinant Zebrafish GOLPH3 | +Inquiry |
GOLPH3-201HF | Recombinant Full Length Human GOLPH3 Protein | +Inquiry |
GOLPH3-5113H | Recombinant Human GOLPH3 Protein, GST-tagged | +Inquiry |
GOLPH3-3796M | Recombinant Mouse GOLPH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLPH3-728HCL | Recombinant Human GOLPH3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLPH3 Products
Required fields are marked with *
My Review for All GOLPH3 Products
Required fields are marked with *