Recombinant Full Length Human GPR1 Protein
| Cat.No. : | GPR1-5559HF |
| Product Overview : | Human GPR1 full-length ORF (NP_005270.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 347 amino acids |
| Description : | GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and neuropeptide binding. An important paralog of this gene is CMKLR1. |
| Form : | Liquid |
| Molecular Mass : | 41.4 kDa |
| AA Sequence : | MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR1 G protein-coupled receptor 1 [ Homo sapiens ] |
| Official Symbol | GPR1 |
| Synonyms | GPR1 G; protein-coupled receptor 1 |
| Gene ID | 2825 |
| mRNA Refseq | NM_005279 |
| Protein Refseq | NP_005270 |
| MIM | 600239 |
| UniProt ID | P46091 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR1 Products
Required fields are marked with *
My Review for All GPR1 Products
Required fields are marked with *



