Recombinant Full Length Human GPR1 Protein

Cat.No. : GPR1-5559HF
Product Overview : Human GPR1 full-length ORF (NP_005270.2) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 347 amino acids
Description : GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and neuropeptide binding. An important paralog of this gene is CMKLR1.
Form : Liquid
Molecular Mass : 41.4 kDa
AA Sequence : MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR1 G protein-coupled receptor 1 [ Homo sapiens ]
Official Symbol GPR1
Synonyms GPR1 G; protein-coupled receptor 1
Gene ID 2825
mRNA Refseq NM_005279
Protein Refseq NP_005270
MIM 600239
UniProt ID P46091

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR1 Products

Required fields are marked with *

My Review for All GPR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon