Recombinant Full Length Human GPS2 Protein, GST-tagged
Cat.No. : | GPS2-5560HF |
Product Overview : | Human GPS2 full-length ORF ( AAH13652.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 327 amino acids |
Description : | This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq |
Molecular Mass : | 61.71 kDa |
AA Sequence : | MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPS2 G protein pathway suppressor 2 [ Homo sapiens ] |
Official Symbol | GPS2 |
Synonyms | GPS2; G protein pathway suppressor 2; GPS-2; AMF-1; MGC104294; MGC119287; MGC119288; MGC119289; |
Gene ID | 2874 |
mRNA Refseq | NM_004489 |
Protein Refseq | NP_004480 |
MIM | 601935 |
UniProt ID | Q13227 |
◆ Recombinant Proteins | ||
GPS2-5560HF | Recombinant Full Length Human GPS2 Protein, GST-tagged | +Inquiry |
GPS2-11208Z | Recombinant Zebrafish GPS2 | +Inquiry |
GPS2-2243H | Recombinant Human GPS2 Protein, MYC/DDK-tagged | +Inquiry |
Gps2-3297M | Recombinant Mouse Gps2 Protein, Myc/DDK-tagged | +Inquiry |
GPS2-5296H | Recombinant Human GPS2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPS2-306HCL | Recombinant Human GPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPS2 Products
Required fields are marked with *
My Review for All GPS2 Products
Required fields are marked with *
0
Inquiry Basket