Recombinant Full Length Human GUSBP2 Protein, GST-tagged

• Cat.No.: GUSBP2-3359HF
• Product Overview: Human GUSBL1 full-length ORF ( ABM84660.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 140 amino acids
• Description: GUSBP2 (Glucuronidase, Beta Pseudogene 2) is a Pseudogene.
• Molecular Mass: 41.8 kDa
• AA Sequence: MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUSBP2 glucuronidase, beta pseudogene 2 [ Homo sapiens (human) ]
• Official Symbol: GUSBP2
• Synonyms: GUSBP2; glucuronidase, beta pseudogene 2; Glucuronidase, Beta Pseudogene 2; Spinal Muscular Atrophy Candidate Gene 3-Like 2; Glucuronidase, Beta-Like 1; Glucuronidase, Beta Pseudogene 4; BA239L20.1; BA239L20.5; B55C20.1; BGLU-Lp; SMAC3L2; GUSBP4; SMA3-L; SMAC3L; GUSBL1; GUSBP4; bGLU-Lp; b55C20.1; bA239L20.1; bA239L20.5; glucuronidase, beta pseudogene 4; glucuronidase, beta-like 1; spinal muscular atrophy candidate gene 3-like 2
• Gene ID: 387036