Recombinant Full Length Human GUSBP2 Protein, GST-tagged

Cat.No. : GUSBP2-3359HF
Product Overview : Human GUSBL1 full-length ORF ( ABM84660.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 140 amino acids
Description : GUSBP2 (Glucuronidase, Beta Pseudogene 2) is a Pseudogene.
Molecular Mass : 41.8 kDa
AA Sequence : MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUSBP2 glucuronidase, beta pseudogene 2 [ Homo sapiens (human) ]
Official Symbol GUSBP2
Synonyms GUSBP2; glucuronidase, beta pseudogene 2; Glucuronidase, Beta Pseudogene 2; Spinal Muscular Atrophy Candidate Gene 3-Like 2; Glucuronidase, Beta-Like 1; Glucuronidase, Beta Pseudogene 4; BA239L20.1; BA239L20.5; B55C20.1; BGLU-Lp; SMAC3L2; GUSBP4; SMA3-L; SMAC3L; GUSBL1; GUSBP4; bGLU-Lp; b55C20.1; bA239L20.1; bA239L20.5; glucuronidase, beta pseudogene 4; glucuronidase, beta-like 1; spinal muscular atrophy candidate gene 3-like 2
Gene ID 387036

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUSBP2 Products

Required fields are marked with *

My Review for All GUSBP2 Products

Required fields are marked with *

0
cart-icon