Recombinant Full Length Human H2AFB2 Protein, GST-tagged

• Cat.No.: H2AFB2-3400HF
• Product Overview: Human H2AFB2 full-length ORF ( ADR82798.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 115 amino acids
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015]
• Molecular Mass: 12.7 kDa
• AA Sequence: MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H2AFB2 H2A histone family member B2 [ Homo sapiens (human) ]
• Official Symbol: H2AFB2
• Synonyms: H2AFB2; H2A histone family member B2; H2A.Bbd; histone H2A-Bbd type 2/3; H2A Barr body deficient
• Gene ID: 474381
• mRNA Refseq: NM_001017991
• Protein Refseq: NP_001017991
• MIM: 301038
• UniProt ID: P0C5Z0