Recombinant Full Length Human HEPN1 Protein, GST-tagged
| Cat.No. : | HEPN1-3478HF |
| Product Overview : | Human HEPN1 full-length ORF ( AAI56584.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 88 amino acids |
| Description : | This gene is expressed in the liver, and encodes a short peptide that is localized predominantly to the cytoplasm. Transient transfection studies showed that expression of this gene significantly inhibited cell growth, and it may have a role in apoptosis. Expression of this gene is downregulated or lost in hepatocellular carcinomas (HCC), suggesting that loss of this gene is involved in carcinogenesis of hepatocytes (PMID:12971969). Also to note is that this gene maps to the 3'-noncoding region of HEPACAM gene (GeneID:220296) on the antisense strand (PMID:15885354). [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 36.08 kDa |
| AA Sequence : | MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFILMLV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HEPN1 hepatocellular carcinoma, down-regulated 1 [ Homo sapiens (human) ] |
| Official Symbol | HEPN1 |
| Synonyms | HEPN1; hepatocellular carcinoma, down-regulated 1; putative cancer susceptibility gene HEPN1 protein; HEPACAM opposite strand 1; cancer susceptibility gene HEPN1 |
| Gene ID | 641654 |
| mRNA Refseq | NM_001037558 |
| Protein Refseq | NP_001032647 |
| MIM | 611641 |
| UniProt ID | Q6WQI6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEPN1 Products
Required fields are marked with *
My Review for All HEPN1 Products
Required fields are marked with *
