Recombinant Full Length Human HESX1 Protein, GST-tagged
| Cat.No. : | HESX1-3522HF |
| Product Overview : | Human HESX1 full-length ORF ( NP_003856.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 185 amino acids |
| Description : | This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HESX1 HESX homeobox 1 [ Homo sapiens ] |
| Official Symbol | HESX1 |
| Synonyms | HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294; |
| Gene ID | 8820 |
| mRNA Refseq | NM_003865 |
| Protein Refseq | NP_003856 |
| MIM | 601802 |
| UniProt ID | Q9UBX0 |
| ◆ Recombinant Proteins | ||
| HESX1-6570C | Recombinant Chicken HESX1 | +Inquiry |
| HESX1-7592M | Recombinant Mouse HESX1 Protein | +Inquiry |
| HESX1-8932Z | Recombinant Zebrafish HESX1 | +Inquiry |
| HESX1-4137M | Recombinant Mouse HESX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HESX1-13749H | Recombinant Human HESX1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HESX1-5579HCL | Recombinant Human HESX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HESX1 Products
Required fields are marked with *
My Review for All HESX1 Products
Required fields are marked with *
