Recombinant Full Length Human HESX1 Protein, GST-tagged

Cat.No. : HESX1-3522HF
Product Overview : Human HESX1 full-length ORF ( NP_003856.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 185 amino acids
Description : This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq
Molecular Mass : 47.8 kDa
AA Sequence : MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HESX1 HESX homeobox 1 [ Homo sapiens ]
Official Symbol HESX1
Synonyms HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294;
Gene ID 8820
mRNA Refseq NM_003865
Protein Refseq NP_003856
MIM 601802
UniProt ID Q9UBX0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HESX1 Products

Required fields are marked with *

My Review for All HESX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon