Recombinant Human HESX1 protein, His-tagged
| Cat.No. : | HESX1-2449H |
| Product Overview : | Recombinant Human HESX1 protein(1-185 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-185 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HESX1 HESX homeobox 1 [ Homo sapiens ] |
| Official Symbol | HESX1 |
| Synonyms | HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294; |
| Gene ID | 8820 |
| mRNA Refseq | NM_003865 |
| Protein Refseq | NP_003856 |
| MIM | 601802 |
| UniProt ID | Q9UBX0 |
| ◆ Recombinant Proteins | ||
| Hesx1-1115M | Recombinant Mouse Hesx1 Protein, MYC/DDK-tagged | +Inquiry |
| HESX1-4137M | Recombinant Mouse HESX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HESX1-4583H | Recombinant Human HESX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HESX1-2449H | Recombinant Human HESX1 protein, His-tagged | +Inquiry |
| HESX1-3522HF | Recombinant Full Length Human HESX1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HESX1-5579HCL | Recombinant Human HESX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HESX1 Products
Required fields are marked with *
My Review for All HESX1 Products
Required fields are marked with *



