Recombinant Human HESX1 protein, His-tagged

Cat.No. : HESX1-2449H
Product Overview : Recombinant Human HESX1 protein(1-185 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability August 19, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-185 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name HESX1 HESX homeobox 1 [ Homo sapiens ]
Official Symbol HESX1
Synonyms HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294;
Gene ID 8820
mRNA Refseq NM_003865
Protein Refseq NP_003856
MIM 601802
UniProt ID Q9UBX0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HESX1 Products

Required fields are marked with *

My Review for All HESX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon